SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_06966T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_06966T0
Domain Number 1 Region: 322-516
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-24
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 2 Region: 127-304
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-19
Family Laminin G-like module 0.04
Further Details:      
 
Domain Number 3 Region: 564-747
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-16
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 4 Region: 793-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000918
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 824-861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000387
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 6 Region: 2-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000186
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  WUBG_06966T0
Domain Number - Region: 544-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 68-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00896
Family EGF-type module 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WUBG_06966T0
Sequence length 862
Comment | WUBG_06966 | Wuchereria bancrofti calcium binding EGF domain-containing protein (863 aa)
Sequence
MPCLNGGKCFTNFTNTSGFKCICDERFSGTRCESIVQGMECVPECVAGESCEQRNGTFVC
IKTQISCDDCVHSFRCIENGKYAVCVCDTSWTGPKCDQQIEECQNLFCTQHQICRNEATS
AGTITSCGCAPGLIGTNCTINTAVTFHNTSFFLYQSPNSIIGLQQSDYTLKVTFRTTVDD
THILSTEDILSQIQFALNVRRGYLYGNFTGFVYRKLLPFTVNDDHWYTILFSNTNKTVSL
EIREGDFVLSRLKMKERRNMGIYWTRIGKGRADGFRGCVRDLFINGEFTDMLKSANVFGV
IEGCQHSKLCSPNPCQNDGTCIDQWDEFRCECKKPFLPPYCIQQTDEVTFGHHNLKSRLE
LDIEQNLEDIKLDTDIDFLMRTNKPNGTLLYLGEKSDEDIGTFIALQILNGSLNIRTRLG
GKKVFSRNISDKIDDNKVHLISLVRDRNNFTITIDDGVTSTKFDIENRFDHPLLADTLIL
GSSEDLPTDAFSNNDYFKGTLQDLRINNRVVPLTTLPTNIEVQQFGIEIEKDNIQQGTVS
DDICTLLKPCVNGECSNTFNDFECICENSWIGKRCNERDHCALLSCGANMTCTNYDGGYV
CSSPATFISTSFAKFKLENGGVTMDISKPLQISFMLRTRSLSGQIIYLKTPTSFLSLSLE
DGLLVYEALINDNMKKQRTNLVVNDGAVRSVDINQNGLYIDGKLNANNLSLPLSVNTFDF
NDNLTLVIGQRNDQLPSFDGCLENIQIGIAPPISFFVDSRAGNLLENTMHFKLMKLRNII
DNLCYADDLCGLVNPCKNDAVCRDLWNKRVCECQPGFTGTFCETRINRCENHICKFGACI
SGIDEYSCVCLPGYDGQFCDEK
Download sequence
Identical sequences J9F470
WUBG_06966T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]