SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_08285T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_08285T0
Domain Number 1 Region: 206-307
Classification Level Classification E-value
Superfamily SH2 domain 1.04e-22
Family SH2 domain 0.00018
Further Details:      
 
Domain Number 2 Region: 16-168
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-16
Family Phosphotyrosine-binding domain (PTB) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WUBG_08285T0
Sequence length 315
Comment | WUBG_08285 | Wuchereria bancrofti hypothetical protein (316 aa)
Sequence
MLEDGDVISPSDEELLKELKTGQTFYLKYLGSVQVFESLTKKKPEERDNWTRHCMYRICH
QLGVCNENLRPDERLLDKFGEVKVEDKNVELNVALHAFIILDKDGIRILERHPIHVISYA
SSGTEESTKGVFCFVSHVRELGRRCLVFMEPDKNVDFIMETILQIFRLNNKGHGNKLSIE
IATSSESSSNYDHQTSVNICNLPAALGLDRQPWYHGEMGRATAESVLRNEGDFLVRISPN
TANNFVLSGIANSIARHFLLLDENDQKVRKQQQVFETIVELIEYHRGENVPIISEGSELH
LIRPIVKFTASLPRR
Download sequence
Identical sequences J9EUJ8
WUBG_08285T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]