SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_09517T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_09517T0
Domain Number 1 Region: 311-527
Classification Level Classification E-value
Superfamily vWA-like 5.79e-50
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 242-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000447
Family EGF-type module 0.05
Further Details:      
 
Domain Number 3 Region: 196-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family EGF-type module 0.026
Further Details:      
 
Domain Number 4 Region: 29-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000572
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  WUBG_09517T0
Domain Number - Region: 82-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 541-627
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000895
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WUBG_09517T0
Sequence length 627
Comment | WUBG_09517 | Wuchereria bancrofti hypothetical protein (627 aa)
Sequence
ADGYTCQCKSGFADISPSGTPGRICRTRVNECAEPQKYHVDCDSNAVCVDTDEEYTCSCR
PGFADISSSFERLPGRRCVEAINECLNPSMNDCSENAICEDAKEGYICTCLQGFVDASSN
ITHYPGRVCHKPKQEKLHDNDASKGSLITCNPDKPKCGTNEVCTDRKARGKFICDCAENA
FRFTDNTCRFYAACIGVNDCDKNAVCANAFDSYICQCRPGFIDISPDPEGKPGRICKELI
NECATGIHNCSSYATCIDATDGYMCICNDGFVDTSSQFQLAPGRRCSNASNECIDQTLNT
CDENADCIDTPDSYTCQCYAGFVDVSSSANLQPGRVCTVQTTCPKQKTDLMFLIDGSGSI
GSYVFKNEVLRFIKEFVELFDIGLDNTRVGLIQYSDQIRHEFDLSQYTDKASVISAISQV
QYLTGLTRTGAAIQHMVMEGFSERRGARKEGDDVARVSIVITDGRSQDNVTEPAINARKS
HINMFSVGVTDHVLGPELEAIAGSPLRWFHVDKFKDLDTRLRSLIQKAACPSPEPKPRPP
GGCNPSTQTGCDRTLNEVCVQGNGSAQCVCPEGFQRHPSTRRCGGNQCNPDLPTSCPHPE
ICVIAPFSNYLCVCPKGYLRDQRSGIC
Download sequence
Identical sequences J9EWM1
WUBG_09517T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]