SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_10646T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_10646T0
Domain Number 1 Region: 311-434
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 570-698
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000259
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 473-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000439
Family EGF-type module 0.027
Further Details:      
 
Domain Number 4 Region: 514-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000611
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  WUBG_10646T0
Domain Number - Region: 446-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0116
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WUBG_10646T0
Sequence length 703
Comment | WUBG_10646 | Wuchereria bancrofti hypothetical protein (704 aa)
Sequence
MTNVERKTSRIELDKTTTVLELDRITKLAASEIATTKRIAEDETLESVMSTKSEMESATK
RMSPPIGSIEREPTSIQETAFSVSGTDIHTTAFLAFKTSTSPSFPSSETVTNYGSIITVA
NSRNFPSALAEEVISKQFLKPVSRVSPLTTTSASSVGNTIVFQHSESSKTDLSPTPTFSR
SNLETTLTDSMNALKIESKTVGWTIKPEETGKNGIALEMKTAVPGLISEIKISESTHYPS
GISIKVEQTPTKSSVSDEGLFKIIQQETASPIYANISKSEEYLTATKTVYTMQETTGTPI
TQNNIPATSLRCQSSNECGADAYCERRSGVCRCYSGFDGQPPMTPCVDINECERHLDDCD
LTSRCSNIVGGFMCFCETGYRMSKEHICVDIDECQERAGRPCNQHAICINIPGSYQCQCN
LGYTGDGYTCIPIDKRYCKEEELAKSNCGTNHLCLVDVKGEIDCETCKKGFVKEGTDCTD
INECAQSGICHENAFCENIDGSYSCHCRSGYKGDGYKCDDIDECQNNPCHPQGICTNLPG
SFSCKCPDGWVGDGKNECINPFDTACLDKLSVCNQVNHTSCLSVTLGVITTSICECSANY
RYNHIKHICEDIDECVENRHSCDPSNSICVNTVGGYTCVCSLGYEGVGGVCVDVNECERG
VADCNVPYRCENHLGSVGCKCPPGFIGNGVHCIGMCHNYIFKI
Download sequence
Identical sequences J9AVA1
WUBG_10646T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]