SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_10944T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_10944T0
Domain Number 1 Region: 1-40,85-129
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000439
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 55-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000597
Family EGF-type module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WUBG_10944T0
Sequence length 137
Comment | WUBG_10944 | Wuchereria bancrofti hypothetical protein (138 aa)
Sequence
SCQQGYYLNWHYKQCLNCSYGYYQDEIGSNACKQCPSGTTTRIRGATSIETCVSTNQCAS
GEHRCHWLAACIDLPDNENKPAYSCRCQPGFVGNGFTCTDICLNLCYNNAECIKTSRGEP
RCICKPGYRGLRCEIKK
Download sequence
Identical sequences J9E7P7
WUBG_10944T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]