SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_13260T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_13260T0
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000036
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 2 Region: 112-143
Classification Level Classification E-value
Superfamily Notch domain 0.000000523
Family Notch domain 0.0029
Further Details:      
 
Domain Number 3 Region: 47-79
Classification Level Classification E-value
Superfamily Notch domain 0.00000122
Family Notch domain 0.0016
Further Details:      
 
Weak hits

Sequence:  WUBG_13260T0
Domain Number - Region: 91-105
Classification Level Classification E-value
Superfamily Notch domain 0.00157
Family Notch domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WUBG_13260T0
Sequence length 248
Comment | WUBG_13260 | Wuchereria bancrofti hypothetical protein (249 aa)
Sequence
MCLNGGTCVDGVNSYRCRCQRGFTGKNCQHQIDLEQFNVTNLLEHELCAKHDCIAKAGNK
VCDQVCNYYACHYDSGDCSAGTKPFKNANHQICNNQECLFDGFDCDSIPEQCSKNDYCTT
HYADGQCDRECNVIGCGWDGGDCDSFDVETPLEGNIIVILLISPDEFLRNAQTFLFTLSQ
KLRGAVHIRTTNGKPMIYSWSSEGGIGELYDVAPEKRHLLVSNLQRVKRQSNFCYKSILQ
LTCISFLG
Download sequence
Identical sequences WUBG_13260T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]