SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_13357T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_13357T0
Domain Number 1 Region: 54-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000046
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 12-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000712
Family EGF-type module 0.0082
Further Details:      
 
Weak hits

Sequence:  WUBG_13357T0
Domain Number - Region: 77-132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0206
Family Pentraxin (pentaxin) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WUBG_13357T0
Sequence length 144
Comment | WUBG_13357 | Wuchereria bancrofti hypothetical protein (144 aa)
Sequence
MINFTDFIGAGCQYELDACQEGVCQNDAICQLLEGGNYRCICEPGFTGQNCETNINDCSP
SPCPLAATCIDQVGGFFCQCPFNMTGLNCDKVIDEDYDFHFYDPILPAAAALSVPFKFTS
SAFTISLWVKFDVPLTRGTVLTLY
Download sequence
Identical sequences J9AN73
WUBG_13357T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]