SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_14137T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_14137T0
Domain Number 1 Region: 6-62
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-17
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 2 Region: 149-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number 3 Region: 238-278
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000562
Family Integrin beta tail domain 0.007
Further Details:      
 
Domain Number 4 Region: 192-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Integrin beta EGF-like domains 0.006
Further Details:      
 
Weak hits

Sequence:  WUBG_14137T0
Domain Number - Region: 114-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00865
Family Integrin beta EGF-like domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WUBG_14137T0
Sequence length 287
Comment | WUBG_14137 | Wuchereria bancrofti hypothetical protein (288 aa)
Sequence
GHTLKETNVCDGIKVGDEVSFEVTLEATHCVKERDFNLKIGPSGLDETLQVDVHVQCDCD
CETDRVVHNSPICHGKGDLVCGVCICHGTNVGRHCECDAPGLSTVALDAKCKRTNESAIC
EGRGVCNCGVCECFERDNMNEKISGQFCECDNFNCPRHDRKICAGHGTCDCGQCTCKPGW
TGRACECPLSLDSCMAANGKVCNGQGECICGRCRCFSDGPGNRYSGPKCEICPTCPSKCV
EHKPCVMCQQWQTGPYNETQCDECTFTVIPVKELPGYHFIIARFTYC
Download sequence
Identical sequences J9DYN9
WUBG_14137T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]