SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_16698T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_16698T0
Domain Number 1 Region: 31-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000978
Family EGF-type module 0.023
Further Details:      
 
Domain Number 2 Region: 84-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000355
Family Merozoite surface protein 1 (MSP-1) 0.067
Further Details:      
 
Weak hits

Sequence:  WUBG_16698T0
Domain Number - Region: 134-218
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000282
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WUBG_16698T0
Sequence length 234
Comment | WUBG_16698 | Wuchereria bancrofti hypothetical protein (234 aa)
Sequence
MINLLIDSELLFILLPFFFSSFGGTVCKEVVNECQNPSLNTCHKNAICIDTADSYKCICK
TGYTDLDELRNPGRNCQKERHNDRCRQGNNDCDRNARCIERDGNDYVCACTAGYRDKSPD
PNRPGRVCIPLIPECDNPTLNDCDSPDRAICTDTDEGYLCRCRQGFLDISPNITSKPGRL
CKPLENECAKKMDDCAQDGGICEDTPDSYTCRCAINYLDVSFDRQNRPGRKCKR
Download sequence
Identical sequences J9E5Y1
WUBG_16698T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]