SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_16853T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_16853T0
Domain Number 1 Region: 65-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000119
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WUBG_16853T0
Sequence length 107
Comment | WUBG_16853 | Wuchereria bancrofti hypothetical protein (108 aa)
Sequence
MEAKVTMLYYLILITFVVLFNLTTAFPHENAQKDSKEMEKIVTKTSDEKPSGSFGLIKTD
EEAICEDELCNNRGTCIGNKDTNFCICRLGYTGMHCENCLFISSIYH
Download sequence
Identical sequences J9AE01
WUBG_16853T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]