SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WUBG_17863T0 from Wuchereria bancrofti v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WUBG_17863T0
Domain Number 1 Region: 97-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000686
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WUBG_17863T0
Sequence length 135
Comment | WUBG_17863 | Wuchereria bancrofti hypothetical protein (135 aa)
Sequence
PSVPETLRDLAYRHENEVEEEINEKEPSTLIPFIAPLGESGSSIPTGSPLIRTSVPWKPQ
TEKLNGFEHVYEGRFPRIFMGNVPTKAKLKMTTVTGMNKCTEKPCENGGRCRLDTGAEVG
FTCSCKEGWTGPLCQ
Download sequence
Identical sequences J9DNZ2
WUBG_17863T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]