SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|344203728|ref|YP_004788871.1| from Muricauda ruestringensis DSM 13258

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344203728|ref|YP_004788871.1|
Domain Number 1 Region: 38-83
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000371
Family BAR domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344203728|ref|YP_004788871.1|
Sequence length 94
Comment hypothetical protein [Muricauda ruestringensis DSM 13258]
Sequence
MNKKEFKAKANQTIDGVSAKIHELKAKKESASGDAKSKYDKAIRDLESKRSDLESKYADL
KNASEEKWDEAKDAFSSASDSFKEGFDKLKGLFS
Download sequence
Identical sequences G2PPE8
gi|344203728|ref|YP_004788871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]