SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA11G21880.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA11G21880.1
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-22
Family Thioltransferase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ONIVA11G21880.1
Sequence length 109
Comment pep:novel chromosome:AWHD00000000:11:23049673:23050002:1 gene:ONIVA11G21880 transcript:ONIVA11G21880.1 description:""
Sequence
MAERVAMLASERAVVVFTKSGCCMCTAVTTLLGELAVSAAVHELDRDPLGKEMERELARR
LYGSGGRGGPAVPAVFIGGSLVGGTSKVMAMHLKGELVPMLKSAGALWL
Download sequence
Identical sequences A0A0D3HPK2 A0A0E0BLT7 A0A0E0F892 A0A0E0J532 A2ZGI4 I1R1V9
OMERI11G17750.1 OGLUM11G20990.1 2010565771 OBART11G21660.1 ORGLA11G0175100.1 ONIVA11G21880.1 39946.BGIOSIBCE035210 OsIBCD046251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]