SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA01G17260.3 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA01G17260.3
Domain Number 1 Region: 390-599
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.59e-71
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000106
Further Details:      
 
Domain Number 2 Region: 253-388
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 3.92e-39
Family Domain of poly(ADP-ribose) polymerase 0.0001
Further Details:      
 
Domain Number 3 Region: 105-230
Classification Level Classification E-value
Superfamily WGR domain-like 1.83e-36
Family WGR domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ONIVA01G17260.3
Sequence length 602
Comment pep:novel chromosome:AWHD00000000:1:14272119:14282499:1 gene:ONIVA01G17260 transcript:ONIVA01G17260.3 description:""
Sequence
MWTAAGRRLHQQRDLHAILRTAHRRCCTRPIGGGVGMLIHQFKALLAPKKIYPWRSSHLQ
SLEVRRLHTAPSNAAAAAVTDGGDQDKTKSAKDDDGDDKVQCKKEKIVTATKKGAAVLDQ
YIPDNIKTAYHVLQVGDEIYDATMNQTNVGGNNNKFYIIQALESDAGGNFMVYSRWGRVG
TRGKGKLQGPFSREQAIDEFERKFHDKTDIHWSYRKGSHCYAHKYTWLEMDYGEADKETN
KKTSSITNQLEETKLETRTASFISLICDISMMKQQMVEIGYNADKLPLGKLSKSTILKGY
DVLKRISNVISGADTDRTQLEQLTGEFYSVIPHDFGFKKMSEFIIDTPQKLKAKLEMVEA
LSEIEIAIKLLEDDSSDQDDPLYARYKQFCCDFTPLEVDSEEYSMIKTYLTNTHGKTHTG
YTVDIVQIFKVSRLGEMERFQKFASAGNRMLLWHGSRLTNWAGILSQGLRIAPPEAPISG
FMFGKGVYFADMFSKSANYCCASEACKSGVLLLCEVALGEMNELLYGDFGADNLPNGKLS
TKGVGQTEPNIAESKITDDGMVIPLGKPEKGSLMYNEYIVYNVDQIRMRYILNVNFNFKR
WG
Download sequence
Identical sequences A0A0E0FLD7
ONIVA01G17260.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]