SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA01G40860.2 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA01G40860.2
Domain Number 1 Region: 260-314
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000961
Family Thioltransferase 0.076
Further Details:      
 
Weak hits

Sequence:  ONIVA01G40860.2
Domain Number - Region: 40-50
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0118
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ONIVA01G40860.2
Sequence length 332
Comment pep:novel chromosome:AWHD00000000:1:34727196:34728989:1 gene:ONIVA01G40860 transcript:ONIVA01G40860.2 description:""
Sequence
MLRLPTLLPLKPSPPTTGLNPIHGRRHGHHPSRLLASSAPPPPPPRPPKPEPRTSHENLG
DDTPDFPTTKPRKPRRGRRSEAAAVEDFVRGRLEQVFASIRERDPEVLEGKGDILKRKEE
LSDEEGKEGTGEEEGELKAVVEEEDPSWPLDADIGWGIRASEYFDKHSIKNVTVDGVEID
WEREVEEGWVKEINCLEWESFAFHPSPLIVLVFERYNRAADNWKFLQELEKAAKVYWNSK
DRLPPRVIEVVGHMLNLIEFQTVKVDMNIERDLAFALQVKECPQLLFLRGNKILYREKEL
RTADELVQMIAHFYYNAKRPSCVNPEAIAPPC
Download sequence
Identical sequences A0A0E0FV92 A0A0E0N4F9 A2Z5H3 A2ZZ71
ONIVA01G40860.1 ONIVA01G40860.2 OsIBCD029889 39946.BGIOSIBCE031415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]