SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA02G21520.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA02G21520.1
Domain Number 1 Region: 70-261
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.03e-68
Family Glutathione peroxidase-like 0.000000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ONIVA02G21520.1
Sequence length 263
Comment pep:novel chromosome:AWHD00000000:2:19747111:19751374:1 gene:ONIVA02G21520 transcript:ONIVA02G21520.1 description:""
Sequence
MAACCSSLATAVSSSSAKPLAGIPPASPHSLSLPRSPAAAARPLRLSASSSRSARASSFV
ARAGGVDDAPLVGNKAPDFDAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEI
TAFSDRYDEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSF
GVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQDNPDEVCPA
GWKPGDKSMKPDPKGSKEYFAAI
Download sequence
Identical sequences A0A0E0G7U2 B8AJ36
ONIVA02G21520.1 39946.BGIOSIBCE007314 OsIBCD006751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]