SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA02G27980.5 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA02G27980.5
Domain Number 1 Region: 214-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.88e-22
Family UAS domain 0.00036
Further Details:      
 
Domain Number 2 Region: 433-486
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000331
Family UBX domain 0.04
Further Details:      
 
Weak hits

Sequence:  ONIVA02G27980.5
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily UBA-like 0.000173
Family UBA domain 0.07
Further Details:      
 
Domain Number - Region: 163-202
Classification Level Classification E-value
Superfamily ARM repeat 0.0691
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ONIVA02G27980.5
Sequence length 569
Comment pep:novel chromosome:AWHD00000000:2:25052495:25055213:1 gene:ONIVA02G27980 transcript:ONIVA02G27980.5 description:""
Sequence
MDNAAAVATFMEITSCGSQEAAVQHLASCRWDLDAALNRYFIFGGVLAAAPAPAPVADVA
PPAALDDGVRAPIPARSDTLYGDMYGGARRRDRDSRPAPSVWEDEPPAVTPSVAPVYIQM
PSANPAVAPVQIQMPSETAASVPAAPVPVHAPSQPPVVAIAVKKEQNEKDEEEDNGRDDD
DDGYSDSDYGTDTDDDDDRYDECIEKTPSPPPKSTQQQATTLAEMYRRPRELMHDADFHS
TKVHAARQDRWLLLNLQSAGEFASQMHNRDLWADQVIARVVRESFVFSLLENSYGDDDDE
ASKVCCFYKLHYQLPAVLVIDPITGQMLAKWSGVIQPETFLVDIEEYSKSKPSMRSKPYI
FQRKPMPVRSAPAASEQHHQEPAMVDTAAPMDIHNVQEPDTAAPAPAPVVEHGVQQPATA
GAGAQQPADEQDDDDQPMEGEKMYRMRVRFPDGSVVTKEFGCKRRVAVLFNYCRSVLHDK
PQAFKIKRLLGVGGAFHELPQDDVAIGATTVGEDFELAAGSSNTARKCGRRRLGLELAGG
SGATTRNNRYQRGPELGGGGGVNVTRRYR
Download sequence
Identical sequences A0A0E0GAB2
ONIVA02G27980.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]