SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA03G02360.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA03G02360.1
Domain Number 1 Region: 86-127,184-268
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.44e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 4-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000105
Family Glutathione S-transferase (GST), N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ONIVA03G02360.1
Sequence length 321
Comment pep:novel chromosome:AWHD00000000:3:1615988:1617108:-1 gene:ONIVA03G02360 transcript:ONIVA03G02360.1 description:""
Sequence
MAPASVKVFGSPTSAEVARVLMCLFEKDVEFQLVRVDAYRGTQRMPQYLKLQPLGEALTF
EDDNLTLSESRGILRHIAHKYARQGNPDLIGTGALERASIEQWLQTEAQSFDVPSAEMVY
SLAFLPPNMPKQNDNGNGNGNGNGYGNSNGREVQVANASSKRVVAGATDGKTAASGANGN
KQQQKEEEMRKVFEKSKKDLEKLLDIYEQRLEEAAYLAGDKFTIADLSHLPNADRLASDP
RSRRMFEARKNVSRWWNNISSRESWEYVKSLQRPPSAAHAGNAQQQQQQQSPSAGNNYQH
QQGQGQGQQHYRNEQVENYNN
Download sequence
Identical sequences A0A0E0GGE1 A2XC62
39946.BGIOSIBCE009545 ONIVA03G02360.1 OsIBCD008770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]