SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA03G04930.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA03G04930.1
Domain Number 1 Region: 165-251,301-382
Classification Level Classification E-value
Superfamily SET domain 1.31e-26
Family Histone lysine methyltransferases 0.095
Further Details:      
 
Domain Number 2 Region: 6-118
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000116
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ONIVA03G04930.1
Sequence length 536
Comment pep:novel chromosome:AWHD00000000:3:3637848:3639458:-1 gene:ONIVA03G04930 transcript:ONIVA03G04930.1 description:""
Sequence
MATPGLDDDSLQQLRSRATQLLLKENWTEYIAVCSLIIEAFDAAAACKDRRVLCSTLAHR
ADARARLGDAPGALADCDAALAADPAHPGALLSKGAVLRGLGRYARAAECFRAALAVSGT
DEVREMVEQCKRLDAQARSGAVDLSEWVLAGFSGKCPDLAEHVGAVEVRRSAHGGRGVFA
VKNIEAGANLVISKAVAIGRGVIPDAADSGEKMVVWKDLVDKVLDAAEKCPRTASLIYTL
STGEEPEDELPIPDMAHFKQETEELDDGTAMAPKASLDVDKILKVLDVNCLTEDAAPSAN
LLGSNGVVNCGVGLWILPAFINHSCHPNARRTHVGDHAIVHASRDIKAGEEITFAYFDVL
TPASKRREAARAWGFECQCDRCRFEASDAIVGQELTKLENELVNGRGGDMGALVVRLEER
MRKSMVKERRKAFLRASFWSAYSALFDSDKLVRKWGRRVPGEAAVAESVAGAIGGNESVL
RAMLRGADNGNGCGNRLEVEDKVVRIGRATYGRVVKRQAMRALFRLTLDADSNKSL
Download sequence
Identical sequences A0A0D9Z2L8 A0A0E0GHD6 A2XCZ3
39946.BGIOSIBCE009818 OsIBCD038519 OGLUM03G04990.1 ONIVA03G04930.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]