SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA04G18440.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA04G18440.1
Domain Number 1 Region: 43-263
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.22e-20
Family BAR domain 0.065
Further Details:      
 
Domain Number 2 Region: 311-368
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000129
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ONIVA04G18440.1
Sequence length 377
Comment pep:novel chromosome:AWHD00000000:4:19632497:19636005:-1 gene:ONIVA04G18440 transcript:ONIVA04G18440.1 description:""
Sequence
MEALWKQASRLKEQVSRQGVFKPFGAAYGNSENAFTDESEVNLHQRLEKLYLSTRAAKHF
QRDIVRGVEGYIVTGSKQVDIGNKLSDDSQKYGTGSTCTSGNTLSKAAMYYGKARSLMEK
ERGNMLRAFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAEAQAVEVSRRQNRVRES
APNGDVITKLEAAEYKLEELKSSMVGLGKEAVAAMAAVEAQQQRLTLQRLIAMLLISLAL
KVEAERAYHQRVLEILDHLEQEMVSERQNIEAPPTPSAENYMAQPPPSYDEVNGMFASSS
VDDSVTSVDFFLGEALDSFKAESESELNLSAGDIVIVRKISTNGWAEGECKGKAGWFPHG
YIERRERVLASKVPHIF
Download sequence
Identical sequences A0A0E0H3P1
ONIVA04G18440.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]