SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA04G27230.2 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA04G27230.2
Domain Number 1 Region: 170-245
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000501
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 274-305
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000183
Family CCCH zinc finger 0.0015
Further Details:      
 
Domain Number 3 Region: 104-134
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000602
Family CCCH zinc finger 0.0023
Further Details:      
 
Domain Number 4 Region: 38-62
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000445
Family CCCH zinc finger 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ONIVA04G27230.2
Sequence length 309
Comment pep:novel chromosome:AWHD00000000:4:26462561:26470229:1 gene:ONIVA04G27230 transcript:ONIVA04G27230.2 description:""
Sequence
MEGASAARKRSRPDTANGGAAGGKRSRETESFQTGLSSKSKPCTKFFSTIGCPFGEGCHF
SHFVPGGYQAVAKTLNLGNPAVPAPARAPMDHAAGGNSHPASSGKTRMCTKYNTAEGCKF
GDKCHFAHGERELGKPAYMSHESAMAPPMGGRYGGRPEPPPPAAMGPPAGNFGASATAKI
SVDASLAGGIIGKGGVNTKQICRVTGVKLSIRDHESDPNLKNIELEGNFDQIKQASNMVG
ELIATISASTPAKKPAGSAAGAAPAGRGGPGGRSNYKTKLCENFVKGTCTFGDRCHFAHG
ENEQRKGAA
Download sequence
Identical sequences A0A0E0H751
ONIVA04G27230.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]