SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA05G27520.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA05G27520.1
Domain Number 1 Region: 80-220
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.87e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 8-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.75e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ONIVA05G27520.1
Sequence length 230
Comment pep:novel chromosome:AWHD00000000:5:25973737:25974508:-1 gene:ONIVA05G27520 transcript:ONIVA05G27520.1 description:""
Sequence
MAGRNNHELKLLGTWPSPFVVRVRLALGLKGLSYEYVEQDIRDKSELLVVSNPVHKKVPV
LIHGGKPVCESQIIVQYIDEAFPGAGASLLPSDPHERAVARFWATYIDDEFATKFRAMGE
AKEEEEKDEAAAQVFAALETLEEAMKGKVFFGGDSAGYVDVALGGFLGWIKAAEALAGVA
FLDGARTPLLAAWAARFSALEAAKEAIPSVERLREFHVAMHAAAATVAGN
Download sequence
Identical sequences A0A0E0BCY9 A0A0E0HIC9 A2Z9L7
OGLUM10G16480.1 39946.BGIOSIBCE032854 OsIBCD031289 ONIVA05G27520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]