SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA06G25000.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA06G25000.1
Domain Number 1 Region: 168-260
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 259-290
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000497
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 98-129
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000445
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 4 Region: 34-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000353
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ONIVA06G25000.1
Sequence length 295
Comment pep:novel chromosome:AWHD00000000:6:23968248:23970941:-1 gene:ONIVA06G25000 transcript:ONIVA06G25000.1 description:""
Sequence
MEAGGGKRAAPEGTNGAAKRARASESSQVGVGSKLKPCTKFFSTSGCPFGSSCHFLHNFP
GGYQAAAKMTSHGGTAVAAPPGRMPLGPGAPNGPPTSSVKTRMCNKYNTAEGCKWGSKCH
FAHGERELGKPMLLDNSMPHPMGSMPFEAPPMPGPDIVPPSTFGASATAKISVDASLAGG
IIGKGGTNTKHISRMTGAKLAIRDNESNPNLKNIELEGTFDQIKHASAMVTELIVRISGN
APPAKNPGKGSHAGGPGSNFKTKLCENFNKGSCTFGDRCHFAHGESELRKPPAAA
Download sequence
Identical sequences A0A0E0HTJ3
ONIVA06G25000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]