SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA10G15150.1 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA10G15150.1
Domain Number 1 Region: 1096-1247
Classification Level Classification E-value
Superfamily VC0467-like 1.83e-23
Family VC0467-like 0.0017
Further Details:      
 
Domain Number 2 Region: 911-951,979-1042
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000167
Family PDI-like 0.0069
Further Details:      
 
Weak hits

Sequence:  ONIVA10G15150.1
Domain Number - Region: 43-141
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000847
Family PDI-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ONIVA10G15150.1
Sequence length 1252
Comment pep:novel chromosome:AWHD00000000:10:15876791:15883421:-1 gene:ONIVA10G15150 transcript:ONIVA10G15150.1 description:""
Sequence
MRLPLLTAALPLLLSLLAASQLGASATAAAASSGAAASGRAEWQVLTRANFSSQIRLHPH
ILLVITMPWYGESRSLMAEIERLVAADEQELGHLKLMAVYRNSEKLLTDVLGATEGIKFI
YYQRSLPFKYEGKLRAREILSSVHYIMSLKHAEAPFVVLHTKEDVEAFVESTDKAVVLSE
FCGWFSKLAHGGSNRTEGTSSKNHTENVDISGKALTGESDGPLELVIEDEELIFGGGVQL
AGFPWKGGFTLANGSMSDQNGITTDENRKLCTAEKLQQFESFYAKLTALSRDYFLPPEKV
RFGLITERSSLPSSEFINEGNSETWFLSVHYLGCTNCSIVAKEGDDLRSLLQSYHNLNIN
EMDIDASGIATFPASRSSAILFIDRLSDSSKVRDESKLSLKLLREYVQKNYPSHFSTGGL
TSGKSRMSSKAVPSLVSTGRSAHTERTRLNDWASKLMEIGEKMSVMVVNDGESISYRSDS
QGSTDNPLYDILTKLIHKTRPAHRSKKTKISFVAKDVAIKKLSDDSEVQVVESLSIRDSQ
LERNEGSCASSDGGNDDYTEDSVHENRATEAEYINDRQAPIKLEKGPANYCDNNEKHLES
SDTEVEEEHKTKASDVSLDLQEDISVDVHSSNAPKNFCKINKEDLDCSDTKMEEQEHKTE
ASDTSADLQEEVSTDVHSSNEVGHILHKHKDEETVREALDILEPDGTNVNFNQQKSGSAN
QQDAVFSVLGQESRRIEDAIYEDNLFILDEGSEESDSKYPVHAALSSSSSLVGDNTYYTE
QETPSIPDEHFAGSLFFSDGGYRLLQTLTGGSRMPSLVIIDPIQQKHYVFPDEIEFTYPS
LANFLDHFMNRSLSPYYRSALSVISSKELLRPPFINRDFHEADSIPQLTTSNFCMLVFGF
EGCVSKSELPFSNTENIASAWKKDVLVLFSNSWCGFCQRTELVVREVYRSFKNFLSSNSQ
FLQAQDLQIEEKEEESTMKGFPAIYLIDCTSNECHHLLKSVGKEERYPTLLFFPAENKSA
ISYERGISVSNLFEFLESHASNSPHLLEYKGFLWKKKTVVQGDAPQAIQFDNSDKSSNDV
GSHSPSHSERNEARVLTGSVLTATSKLGSAVPFDNSQVLIVSADSREGFHGLIINKRLSW
DTFKNLDGSMEPIKHAPLFYGGPVVVQGYYLVSLSRVAFDGYLQVIPGVYYGNVAATAQV
TRRIKSGEQSAENLWFFLGFSNWEYSQLFDELSEGAWQVSEEPIEHLVWPEN
Download sequence
Identical sequences A0A0E0IU71 A2Z8P2
ONIVA10G15150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]