SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ONIVA11G09720.2 from Oryza nivara 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ONIVA11G09720.2
Domain Number 1 Region: 93-179
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 0.0000000506
Family Plant cytotoxins 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ONIVA11G09720.2
Sequence length 187
Comment pep:novel chromosome:AWHD00000000:11:9456216:9460274:-1 gene:ONIVA11G09720 transcript:ONIVA11G09720.2 description:""
Sequence
MAAAPAPALAPDAAALQLQVLHPLVLGSECRAYAYMHMHMHMLEGVGPLGAWIRMWFGYS
PQLVFLLICIRNSWLYRKVLSPDLWFTQNELAIRTFIIDIEHVGDRTYHTLMRSIHEYNL
QNSPFTCLNAAVTPAGGYHMILLYKGQKSVRLLFRDSDGYLVAVEDDLGSWYGSKIYQSY
HSLIQLK
Download sequence
Identical sequences A0A0E0J0S6
ONIVA11G09720.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]