SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MVLG_05020T0 from Microbotryum violaceum 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MVLG_05020T0
Domain Number 1 Region: 25-128
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-21
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0047
Further Details:      
 
Domain Number 2 Region: 168-266
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000418
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MVLG_05020T0
Sequence length 429
Comment pep:novel supercontig:GCA_000166175.1:supercont1.62:61948:64224:-1 gene:MVLG_05020 transcript:MVLG_05020T0 description:"hypothetical protein"
Sequence
MPSTSTLTSNEKSLIKKHAPSAPGDKIHTAAVARVYYAFPDPAKWSYSGISGALVFGWGS
QGGWIKVVDLAGTRGTIWIHEIVEEMQYYQDRTFFHTFPSDDCMIGLAFSSESEAAEMFK
KVSMRSKYASKAGQSSKKSSSASAATSSPSGKKKKKGVIDKSMIGAPTGFSHVAHMGFDT
EKGFSSSNVDPSWERLLGQLEGQGISRNQIIKNEAFIRNYVEGSGGPSAVALPAPPPPSG
PPSRKVPPPAPASRVVQNIKRKPPAPPAPRRVPASDSSVDAAPTLPPSRAPVARPPPPPS
SAPPSRSSVVPHPTPTSPTTGEWPAPWRRTSSSPGPTCSLRRAVCPAATTSSCPSRCTSP
SPTSTRGIACRPTSSSPRRTSRSFGLDPRCWCWSTAQNRCRPGRSSGSSNSRCRNGCRCR
CRCCYGCWR
Download sequence
Identical sequences U5HCZ7
MVLG_05020T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]