SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479156390|ref|YP_007785985.1| from [Ruminococcus] torques

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479156390|ref|YP_007785985.1|
Domain Number 1 Region: 3-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.25e-67
Family ABC transporter ATPase domain-like 0.00000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479156390|ref|YP_007785985.1|
Sequence length 254
Comment ABC-type antimicrobial peptide transport system, ATPase component [Ruminococcus torques L2-14]
Sequence
MTVLEVENLKKIYRPRFGGNQVQALSKVTFSVEEGEYVAIMGESGSGKTTLLNMLAALDK
PTEGEVYLDGKPLSAIREKDLSKFRRDHLGFVFQDFNLLDTFNLKDNILLPLVLQGVDYR
KMNVRMMPIVKELGIAGLLEKYPYEVSGGQKQRAAVARALITDPRLILADEPTGALDSKS
TDELLGVFERINQSGQTILMVTHSVKAASKAGRVLFIKDGEVFHQVYKGEQTDEQFYQNI
SATLTMLATGGERQ
Download sequence
Identical sequences A0A174ZYR1 D4M2L5
gi|479156390|ref|YP_007785985.1| WP_015528106.1.50932 WP_015528106.1.92070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]