SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479157008|ref|YP_007786603.1| from [Ruminococcus] torques

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479157008|ref|YP_007786603.1|
Domain Number 1 Region: 245-338,550-665
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000466
Family ABC transporter ATPase domain-like 0.023
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000011
Family PHP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479157008|ref|YP_007786603.1|
Sequence length 712
Comment PHP domain [Ruminococcus torques L2-14]
Sequence
MRIDLHCHTKKVKTGDAYTRNVTKDKFFQKVIEAEVKIIAITNHNQFDYLQYKEFKDVTE
GYCDIWPGVELDIIGKADQKGNCKRGHLIVIANPKNVELFNTQVQELVNDEDVNTFQIGV
KKVYETLGKCDCIYIPHFHKEPKLSDEDIQELGELLPDSSRLFKETSDYRSLGVFSNFDY
SVIIGSDVQDWDKYEISKFADIRLPVQTFEQFCLLAKKDVQIIDTLLNQKRKKEIPVSPY
KKVNFKLPFYEDINIIFGQKGTGKTEILESLKKYYIENGIAMESYKGNEKDSDFSKMLKV
NDIIATPDKLQLDSMRQQFIDIYNWKEELPTSFEKYISWMETKDNNKNKGRMKITECVHI
EEGVRDRKLESDYKYLKEFTESTFEKIDIEKYLDERERTILMLLLEKLCKNINDAKMQKW
NSDKSIKLTNWSIDKIKAIADKCSDTISKPSSVGFYDFAMGRFKLFENVEEICSTFSVED
KVEKEYLGNLEEKGDIYIQTRYRMLTKESRTDEFKQGITVLRNCKLVIDGIKKAALAENI
SEEVSKFQEFYDDGIKDIGTFIGVSKETALENGEIYRPSNGERGILLMQKLLDSERDAYI
LDEPELGMGNSYITSNILPKLTDLAKRRKTVIIATHNANIAVGTLPYISILRTHENGVYK
TYVGNPFYDELRNIDDETDTKNWTQESMHTLEGGKTAFYDRKDIYESGKQSD
Download sequence
Identical sequences D4M4D3
gi|479157008|ref|YP_007786603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]