SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392414369|ref|YP_006450974.1| from Mycobacterium chubuense NBB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392414369|ref|YP_006450974.1|
Domain Number 1 Region: 145-413
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.58e-47
Family Protein kinases, catalytic subunit 0.00048
Further Details:      
 
Domain Number 2 Region: 522-658
Classification Level Classification E-value
Superfamily TPR-like 0.0000699
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392414369|ref|YP_006450974.1|
Sequence length 767
Comment protein kinase family protein [Mycobacterium chubuense NBB4]
Sequence
MAATDRTDPIEDPAEDPGTQPATYADLAEFNDDSMSTMRPMATQAVFRPNFDEDDDSDAL
LHTGDTEPQDHATTLTRTLSPTRRLGGGLVEIPRVPARDPLAALMTDPVVAESKRFCWNC
GRPVGRSTKDGKALSEGWCPHCGSAYSFLPQLAVGDIVADQYEIKGCIAHGGLGWVYLAF
DKNVNDRPVVLKGLVHSGDAEAQAIAMAERQFLAEVTHPGIVKIYNFVEHEDKHGNPVGY
IVMEYVGGTSLKQATRFKDNARARLPVAEAIGFMLEILPALGYLHSIGLVYNDLKPENLM
VTEDQLKLIDLGAVSRINSFGYLYGTPGYQAPEIVRTGPTIATDIYTVGRTLAALTLRMR
TRKGRYVDGLPEDDPVLAEYDSFGRLLRRAIDPDPRRRFGSAEEMSSQLMGVLREVVAKD
TGVPRPGLSTVFSPSRSTFGVDLLVAHTDVYLDGQVHSEKLTAQEIVKALPVPLVDPTDV
GAAVLSATVLSQPVQTLDSLRAARHGALDSDGVDLSESVELPLMEARALLDLGDVAKATR
KLDDLAERVGWRWRLVWFRAVSELLTADYDSATKHFTEVLDTLPGELAPKLALAATAELA
GTADERKFYNTVWSTDNGVISAGFGLARAQSAAGDRDAAVRTLDEVPATSRHFTTARLTS
AVTLLSGRSTGEITEQHIRDAARRVEALPDTEPRVLQIRALVLGTAMDWLADNSASTNHI
LGFPFTEHGLQLGVEASLRSLARVAPTQAHRYALVDLANSVRPMSTF
Download sequence
Identical sequences I4BDD8
gi|392414369|ref|YP_006450974.1| WP_014813787.1.73529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]