SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392418684|ref|YP_006455289.1| from Mycobacterium chubuense NBB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392418684|ref|YP_006455289.1|
Domain Number 1 Region: 407-557
Classification Level Classification E-value
Superfamily Nucleotide cyclase 5.89e-42
Family GGDEF domain 0.00013
Further Details:      
 
Domain Number 2 Region: 139-263
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.08e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 262-389
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.58e-20
Family Flavin-binding PAS domain 0.05
Further Details:      
 
Weak hits

Sequence:  gi|392418684|ref|YP_006455289.1|
Domain Number - Region: 19-125
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000105
Family BphP N-terminal domain-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392418684|ref|YP_006455289.1|
Sequence length 674
Comment PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein [Mycobacterium chubuense NBB4]
Sequence
MTDEAARAVAAAAAVGLAVADGEVAGLVVQSATGVIEAATPEAEEILGLSLGQMLGRASA
DPRWAAVGVDGVALRPQDHPAIRALMTGRPVYGTELGVHRPGRDRAGEHVWLRVDSVPFN
FVDGAPTNVVVRFSVLSGQRATELRLAESERLYRFLIDNAPDIVAWQLPDTTFLWVSPAS
ETLLGYAPEEMVGRTAYEFMHPYDRATSQATAWMAGRSPSPESIVVRMRHRGGHHIWMEV
AGQVLRDADGNPAQLRTSWRDVTARVEAERGRDAALQLVQSVVANAPIGIAVCTEDGLMQ
QVNAALCTMLGRDSAQLLGRRVDEFLHPEAECSDRFSALLSGELPVDESECRYVRPDGTP
MWGHRTAVVLRDGDGRGDPRLLLHLQDVTERRTAHDALTHAATHDALTGLANRVAFTEHL
AAMRRRLGPDDCSGLLFIDLDDFKAVNDTYGHEIGDELLTVVGARLRESIRPQDFAARLG
GDEFVVHCRYLTDHQGAVDIAKRIVDKLSEPYRLGARTISISASIGVTTTTRDGHDRLMT
SADRAMYRSKKAGRGLITDAADDPAPSGRADSVSMSDTDGDYDDAGPDNTLSPSESLDSD
EVRNDDGDVVVDPPDEWIDAEEDETLDERLAAEVPDVLPRGDAEQATPDRRTYGQIDGTP
EDGTSFYTVLDDDE
Download sequence
Identical sequences I4BQQ3
gi|392418684|ref|YP_006455289.1| WP_014818076.1.73529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]