SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000578 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000578
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.62e-22
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 259-326,574-602,639-707
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.45e-20
Family Ankyrin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000578   Gene: ENSXMAG00000000582   Transcript: ENSXMAT00000000580
Sequence length 725
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556794.1:316061:323727:1 gene:ENSXMAG00000000582 transcript:ENSXMAT00000000580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYEGEFLDDFKHGKGRYSWKNGEFYEGFFYKDLKHGDGEYCWPSGHKFIGKFYLNRKEGY
GHLKYPGGAIFQGLYHSDHRFGPGVFSYPDGNQDVGLWIGQRLLKLCSSLEEGFSLLNFP
DYAAFMQSSDRDHFFIKVFASKSLAGLQVASVLSYVDEDLLSDESFIYPPGIERYSTDGD
HLPLPPGRKRELDRVFHGEKFDEGGNRVRCVERKHLFHLHLRVCFRLQTETVGWNVTDLL
SLKGDSFGPKGPLEVSSELLIQHSFRGELRAVSQILQKGAVYPDVADARGQTALIAATVN
SHNDVIHLLLDSGADIDKMNDERMSALAVCHVLYYPFDSLLSTLIKPPTDTPVSMSPPGE
TSSPINQADIPSKLTDLNIESQITDMNQNQNQNMTDQSSLSQLTEQYSEQLEEEEWKETG
TDEGYDATDKSGDEQSVREAAESELEKLKDELNRDVENLIDSENREITVEDLGEHISLSE
EMLQQSAELLTLARRPPQCDLQEIIRKMTVEEIEVSYMSKIKTLKFLGPLLSQNSDFSQN
FYFNSQNSEKKKFLFFQDFSVRLTDVQTSWFYPLHVAAALHGSEGAQITEMLLHAVTEPD
SRACDQEEIYQPDLVHVYFHLLTCPPFNKYFSVFSGLHGDGGRTALHIACQRDEDYSNAC
KVVELLLSHGARTDLLWSGHSPLSLAIASGNDAAVEEILKAGADPNLPLGWRVGSALCAL
VNFNY
Download sequence
Identical sequences M3ZED6
ENSXMAP00000000578 ENSXMAP00000000578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]