SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000676 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXMAP00000000676
Domain Number - Region: 219-390
Classification Level Classification E-value
Superfamily YWTD domain 0.000167
Family YWTD domain 0.034
Further Details:      
 
Domain Number - Region: 96-188
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0111
Family Apolipoprotein A-I 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000676   Gene: ENSXMAG00000000677   Transcript: ENSXMAT00000000678
Sequence length 458
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556730.1:932027:943674:1 gene:ENSXMAG00000000677 transcript:ENSXMAT00000000678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSLSVVLNPLLFLLLFGYCPTVTIRPKEGWQVYSSAQDADGRCICTVVAPEQNLCSRDA
KGRQLRQLLEKKVQNMSQSIEVLNLRTQRDFQYIMRMESQIKGLRSKFRQIESDRKTLVN
KNFQDLKGKMESLQPLIPVLEQYKTDAKLISQFKEEIRNLSSVLMGIQEEMGAYDYEELQ
QRVLNLENRLHSCMNKLTCGKLMKITGPQTVKTSGTRFGAWMTDPLASLKNNKVWYMDSY
TNNRIVKEYKSISDFVAGVESMTYNLPFKWAGTNHVVYNGSLYYNKMQSNIIVRYSFETG
LVITQRALESAGFHNVYPYTWGGFSDIDLMVDELGLWAVYATNQNAGNIVISRLNPDTLQ
ILDTWNTEYSKRNAGESFMICGTLYITNSHLTGAKVYYAFSTKTSTYEYTDIPFHNQYFH
MSMLDYNARDRALYGWNNGHQVLFNVTLFHIIKTEDDS
Download sequence
Identical sequences M3ZEN4
ENSXMAP00000000676 ENSXMAP00000000676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]