SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001145 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001145
Domain Number 1 Region: 191-425
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-53
Family Voltage-gated potassium channels 0.00094
Further Details:      
 
Domain Number 2 Region: 42-152
Classification Level Classification E-value
Superfamily POZ domain 1.96e-29
Family Tetramerization domain of potassium channels 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001145   Gene: ENSXMAG00000001158   Transcript: ENSXMAT00000001148
Sequence length 497
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557217.1:146980:151444:-1 gene:ENSXMAG00000001158 transcript:ENSXMAT00000001148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVSSSMAGLEVFADAASLPSLNSSVFFSETPEPCARDPLNAVVVNVGGSRYILSQELLAS
HPDTRLGKLVCCGRDSALELCDDADFLQNEFFFDRSSQPFQYVMNFYQTGHLHVMEELCE
ISFLQEIEYWGIDELRINSCCRERYHRRKEQKESLDVRQEFETDEEEEDFVGVLCPGLRR
RLWDILERPESSRAARTFGSLSIFFVVLSVVNMVLISLDLDQDFGVSWLGAGGPQLLDAV
EYVCVLWFTGELALRFTCVRDKCRFSRSIPNVIDLLAILPFYVTLAVESLHGGSTELENV
GRVVQVLRLLRTLRMLKLGRHSTGLRSLGMTIAQCYEEVGLLLLFLSVGISIFAALVFAL
EHDLPASTFTSVPAAWWWATTSMTTVGYGDVRPDSAAGKTLAFLCILSGILILALPIAII
NDRFSACYFTLKVREAALRHADALRRLTHGLPGGGAEPTGGGANLRDAYARSVLEMLRLH
RRERASTRSSGGDELWG
Download sequence
Identical sequences M3ZG03
ENSXMAP00000001145 ENSXMAP00000001145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]