SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001180 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001180
Domain Number 1 Region: 102-144,291-353
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 8.37e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 8-113
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.06e-17
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001180   Gene: ENSXMAG00000001194   Transcript: ENSXMAT00000001183
Sequence length 779
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557013.1:55751:78758:-1 gene:ENSXMAG00000001194 transcript:ENSXMAT00000001183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGRFEFDDGGAYCGGWEGGKAHGHGICTGPKGQGEYSGSWNYGFEVVGVYTWPSGNTY
EGYWSQGKRHGLGVETKGHWIYRGEWTHGFKGRYGVRVSVGSGAKYEGTWNNGLQDGYGT
ETYADGGTYQGQFTGGMRHGYGVRQSVPYGMAAVVRSPLRTSLTSLRSEHSNGTVLQQDV
PVITTTNASGEETPVATPTQLGPSRGGFALTLQVDPEAVKPKKKGLFRRGSLLGKLKKSE
SSTSLSSQKSKISFLRTESALSSNASDTNSTISGDESLAGAEDFPPVEADIDATTTEVYM
GEWKNDKRSGYGISERSSGLKYEGEWLNNQRHGYGCTTFAEGGKEEGKYMNNMLVKAMKK
RVIQLKGTKIKQKVERAVEGAQRAAAIAKQKAEIAASRTSHAKGKSDGAEQAAQASNSES
SIARLVAKELSPSFYQPGPEYLKKRVLLEAVEDQENPDTEIHEPLLAEEEPLLADEEPLP
TPPESPILNELASLMPGSSPARTPSPSPAIINKEDPKLLGPKGRNEDKSMKGSSTKGSLK
PSSAPGSRATTPSVSAAAPASAAPEEGAASSSRQPSRSPSRLSNKIEQGSDLEIKPLQKF
DSEVKPADVPPVTDAPEMNSLISPDEEEEEAPLPSASVPPKAVTPEPKAPEVKTERAPSV
HERPPSTSEKKRPSREGSRPGSRAETRPLPKRQQSPAPPPKRQPSPAPSPKRQQSPAPPP
KRQPSPAPSPKRQLSPSPSPKRQPSPSPSPKRQGPNTIMVCMVILLNIGLAILFVHILS
Download sequence
Identical sequences M3ZG38
ENSXMAP00000001180 ENSXMAP00000001180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]