SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001230 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001230
Domain Number 1 Region: 78-271
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.19e-58
Family CRAL/TRIO domain 0.0000000507
Further Details:      
 
Domain Number 2 Region: 278-389
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.44e-34
Family Supernatant protein factor (SPF), C-terminal domain 0.0000114
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.7e-20
Family CRAL/TRIO N-terminal domain 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001230   Gene: ENSXMAG00000001208   Transcript: ENSXMAT00000001233
Sequence length 404
Comment pep:novel scaffold:Xipmac4.4.2:JH557184.1:114674:126098:-1 gene:ENSXMAG00000001208 transcript:ENSXMAT00000001233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSPKQAKTLTEFRERIQDVLPSLPAQHDHYLLRWLRARNFHLQKSENMIRKHV
EFRKQMKVDTIITDWKPPEVIEKYVSGGMCGYDREGSPIWYDVIGPLDPKGLLLSATKQD
FLKTKIRHIEMLQRECRRQSEKLGKNIESITLIYDCEGLGLKHIWKPAIETYGEILTMYE
DNYPEGLKRVLLIKAPKMFPMAYNLIKHFLCEETRRKIVVLGSSWQEALRKHIDPDQLPV
VYGGTLTDPDGDPRCRTMINYGGNVPKSYYVLESLKVQYDSSVTISRGSSLQLEYDVAAP
SSLLRWQFASDGADIGFGVYRRTKDSRSQKVAEMMQVLPSERYNAHLVPEDSCLTCSEPG
VYVLCFDNSYSVLQSKKVSYNVEVIPPADEQLQTPCGRGDVRLQ
Download sequence
Identical sequences M3ZG88
ENSXMAP00000001230 ENSXMAP00000001230 XP_005813126.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]