SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001409 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001409
Domain Number 1 Region: 476-614
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000445
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 2 Region: 254-370
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000878
Family Spectrin repeat 0.009
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000001409
Domain Number - Region: 52-166
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00288
Family CRAL/TRIO domain 0.016
Further Details:      
 
Domain Number - Region: 344-455
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0403
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001409   Gene: ENSXMAG00000001387   Transcript: ENSXMAT00000001412
Sequence length 750
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556747.1:1362634:1380996:-1 gene:ENSXMAG00000001387 transcript:ENSXMAT00000001412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVTMEANSILPILKKKLAFLSGGKDRRSGLILTIPLNSDQTSMEELGATLDYLLSIPS
DKCKARGFTVIVDGRRSQWNIVKTVVLMLQNVIPAEVSLVCVVKPDEFWDKKVTHFCFWK
EKDRLGFEVILVSANKLTRYIEPCQLTDDFGGSLDYDHSDWLNKRLVFEKFTKESTSLLD
ELTIINDSDKSASVDKDKSTDGALLPSFDPETVLQTGHELLSELQQRRFNGSEGGGGGQA
APAWCPMEEELLAQPQVTKLLDSLREQYTKYQELCRQRNKRAQLDEIHTKVMQVVNWLQG
PGSELLKTQQTIGDSMRAAQALQQKHEEIESQHSEWFAVYVELNQQIAALLSAGEEEEVA
ELKALQQQLSDVCYSQASQLETRQNVLQAAHAFHGTTQELSQQLDGLLGMLCADVSPADG
ASIQQNLKLLEEKLQTVEAGLSSLRQKGTLVLEQMCGQASWSLEEAESPPGEQQDNVQHV
QAVMEEMELRKQRCEDMVDVRRLKMLQMVQLFKCEEDALQAVEWLSELLDALLKTHVRLG
DDSQETRTMLDKHKKFVDVAQSTYDYGRQLLQATVVLCQSLRCTTRSSGDTLPRLNRVWK
QFTVSADERQQRLELALNFHTAAERVLQQERVEVASLDEVDSTGRTLLDRLTLPVIFPDG
SEQFFGSPGDTAATAEGVRERLLLIEERRLQLQEARLLNNEEGEEEEAVNGLEGRLDVIG
EELSEKEEQDEEEKEAEHQDEDSERATQDR
Download sequence
Identical sequences M3ZGR7
ENSXMAP00000001409 ENSXMAP00000001409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]