SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001835 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001835
Domain Number 1 Region: 219-402
Classification Level Classification E-value
Superfamily YWTD domain 0.00000628
Family YWTD domain 0.03
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000001835
Domain Number - Region: 95-172
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0183
Family Apolipoprotein A-I 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001835   Gene: ENSXMAG00000001836   Transcript: ENSXMAT00000001839
Sequence length 457
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557038.1:23439:61775:1 gene:ENSXMAG00000001836 transcript:ENSXMAT00000001839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLLSVLYPLLSLTVFGLYPSMTIGPKEGWQVYSSAQDADGRCICTVVAPEQSLCSRDA
KSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVIKMENQMKGLRTKFRQVEDDRKSIMAK
NFQELKDKMDELKPLIPVLEQYKMDAALISQFKEEIRNLSVVLTGIQEEIGAYDYDELYQ
RVLRLDTRLRSCMGKLTCGKLMKITGPVTIKTSGTRFGAWMTDPLATTRNNRVWYMDSYT
NSKIVREYKTTDDFVSGVVSQTYSLPFKWEGTNHIVYNGSLYYNKYQSNIIVKYNFETGT
VLAQRALEFAGFHNMYPYTWGGYSDIDVMADELGMWAVYATNQNAGNVVISQIDPDTLQV
LKTWNTEYSKRNAGESFMICGTLYITNSHLSGAKVYYAYSTKTSSYEYIDIPFHNQYFHI
SMLDYNARERALYAWNNGHQVIFNVTLFHVIKTEDDS
Download sequence
Identical sequences M3ZHZ3
ENSXMAP00000001835 ENSXMAP00000001835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]