SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002295 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002295
Domain Number 1 Region: 418-673
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-50
Family YWTD domain 0.0000068
Further Details:      
 
Domain Number 2 Region: 2-244
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-29
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 3 Region: 335-411,668-719
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000215
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 289-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000234
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 882-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000949
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 6 Region: 255-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000743
Family EGF-type module 0.021
Further Details:      
 
Domain Number 7 Region: 760-799
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000303
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002295   Gene: ENSXMAG00000002287   Transcript: ENSXMAT00000002300
Sequence length 997
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556711.1:2070505:2085699:1 gene:ENSXMAG00000002287 transcript:ENSXMAT00000002300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGGKNHRRLAAGTGSSILLDFHFREERLYWADRRTGIIYKASVQGAHRQKLYSSDKHI
SGLTVDWIGNGIFWTSSRKGQIKKMDLNGKNERTILRHLSQPSFINVDPTHRFLFWLSGG
SEIQRSDLSGQMKMTVLKLEEQLEALSVDRGDKRLFWVQLGLQGERAVASCDYSGNSLHI
MDLPLQSQSLGISVFLENVYYADAAAGIIRKINKYTGGRPVDVNDKPMVKPPVDIKVVHP
IIQPMADTSSLFPGCNDQSGSCVNVCSRLEEQGVCQCSEGFALSNHGTHCEDVNECAHWN
HGCSLGCENIPGSYFCTCPRGYTLLPDRKTCREITPCGGIIKCGHGCIATEDGAMCVCPE
GSVLQEDGHTCTGCSSADRGGCSQLCSSITPSRWQCGCLPGYRLHQDGKRCIATGPPAFL
IVANLMDVRRMNPDGTEEQTLVKEPRGTILALDFDPVHHRVYFASTSQRTIERIDLNTGS
RDVLVSDGLDSPEGLAIDWVHHTMYWSDRRKSAVDCSTLDGLKRKTVVKEGLEKPRGIAV
HPQAKKLFWTDTGAQPVVESATLEGSSRVIIASTGLMSPTGLTIDFTDDRLFWCDQMRGL
IETAALDGSDRRVLIENQVGRPFDLAVFEDRLWISEWEHQQIRSVHKRTGQKLQRIRGNL
VQPGSVVVVHPLAKPGGNACLHLNGGCAQKCESNQGLSHCSCLPHFTLSADGKSCLSVSS
SNVTAESGDETSNLTSLRNKTLHEESIIPLPALFTEKMIADQNDCYSLHCAVSARCVLEA
GNPLCLCQEGFTGDGQTCLGKVSLYAEITILNRNLTKLAVIYAFTFDLPRVVPARPETMR
HIVCSTSETDCFDRFALESTSPKVTSQTPMDVTTRHHNSNAAEKCPPSHDAYCLYHGVCV
YFPELKIYACNCIRGYLGERCQFSDLEWLELQQAEKEKERNLVIGGCMMALIFIISITAC
ITYCFRSRRLDLKQTSEDNVSEISVTDESMSETTTTS
Download sequence
Identical sequences M3ZJA3
ENSXMAP00000002295 ENSXMAP00000002295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]