SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002346 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002346
Domain Number 1 Region: 430-685
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-37
Family YWTD domain 0.0000324
Further Details:      
 
Domain Number 2 Region: 215-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 377-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 4 Region: 9-46
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 132-170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 93-130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 7 Region: 51-84
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 301-336
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 9 Region: 351-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000402
Family EGF-type module 0.014
Further Details:      
 
Domain Number 10 Region: 260-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 11 Region: 177-208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000694
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002346   Gene: ENSXMAG00000002338   Transcript: ENSXMAT00000002351
Sequence length 735
Comment pep:novel scaffold:Xipmac4.4.2:JH556766.1:1109738:1117938:-1 gene:ENSXMAG00000002338 transcript:ENSXMAT00000002351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDEEGCQETCDEGEFQCAHGKMCIPENEVCDGKPQCRDHSDEMDCWQRTKSCEHRCADGK
RCIPKKFLCDGEPDCLDGTDELNCDFPITSTSACITPSVLCPGSSQCISQHQLCDGQRDC
PDGFDEKECIVQCENPGQFQCSHGRRCIQQEQVCDGQNDCQDHSDETDCSKPIEGCHHLC
DNKTRCVPKTFLCDGEKDCTDGSDEDKCGGHLTRSVACAPHQHRCESGQCISEAFKCDGY
PDCHDHSDEAGCPRAPRCPAQLQCPHSHECLQKEWLCDGEEDCKDGSDENNCNNPPTKCS
TQRKCPYHLYQCGSKECLETRLVCNGINNCIDGSDEGVGCAQRNCSSPSAPTCDHRCVST
PNGPRCYCGAGFRLQSSSKSCMDIDECTSTPATSCSHLCQNTQGSYSCLCHPGFYLEPDN
KSCKTKVDEPLLLASVQSEILILGVHSGTLQLLSSADRPVFALDFHWAEQRVYWQSPDHQ
SIRWADMKSKTKGTLTKDNKGVKSDSIAVDWVGKNLYWVDGLVGQILAIKLSSSIMKSQD
YTVVLGENLEQTSSLVLIPDKGLMLWSEIGSIPQIEQSGMDGSQRKVLVSQDLSWPVSLA
YDFLDDRIYWADEKLHCIGSASLDGDNIKQILQLTETPSPFSVAVFSDRMFWSDTKRRTV
RSADKKTGKNQTVLLKRPGQPFGLKPFHLGSNHCSNSNGGCVHLCLPYPGVNDTSCVPLP
SCPSGEESCLDGSQC
Download sequence
Identical sequences M3ZJF4
ENSXMAP00000002346 ENSXMAP00000002346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]