SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002348 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002348
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000314
Family YWTD domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002348   Gene: ENSXMAG00000002354   Transcript: ENSXMAT00000002353
Sequence length 77
Comment pep:novel scaffold:Xipmac4.4.2:JH556766.1:1110942:1111257:-1 gene:ENSXMAG00000002354 transcript:ENSXMAT00000002353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSQTEIHCAWMDGRNKVVLWKRLSIPISMVFTNDGTRIYWADTGEGIIGSIGVDGSAYR
EYKTGPNLLVSFTLIEN
Download sequence
Identical sequences M3ZJF6
ENSXMAP00000002348 ENSXMAP00000002348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]