SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002351 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002351
Domain Number 1 Region: 136-296
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.75e-45
Family CRAL/TRIO domain 0.0000669
Further Details:      
 
Domain Number 2 Region: 44-132
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.32e-16
Family CRAL/TRIO N-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002351   Gene: ENSXMAG00000002347   Transcript: ENSXMAT00000002356
Sequence length 312
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556701.1:2276871:2282244:-1 gene:ENSXMAG00000002347 transcript:ENSXMAT00000002356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATGTFRMVSEEEQAMRSKLEHLTVKDHGPVFGPCHKLPGHTVQKAKDELHETNERRGS
SLKDLRLMMKERASEGDDLAKLVLDRFGDKPDSLLVRFLRARKFDVTRAHELMKGYVRFR
KDYPELFENLTPEAVRSTIEAGYPVVLPSRDKYGHVVLLFNIDSWDLEEITFDEVLRAYC
VILEKLLENEETQINGFVLIENFKGFTMQHASGIKTAELKKMVDMLQDSFPARFKAVHVI
HQPWYFTTTYNVVKPFMKAKLLERVFVHGEELEGYFKEFDADILPSDFDGKAPVADYQGI
ATQLFGSEDTAL
Download sequence
Identical sequences M3ZJF9
ENSXMAP00000002351 XP_005799853.1.87360 ENSXMAP00000002351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]