SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002395 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002395
Domain Number 1 Region: 106-184
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.93e-23
Family Thyroglobulin type-1 domain 0.00026
Further Details:      
 
Domain Number 2 Region: 46-86
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000439
Family Growth factor receptor domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002395   Gene: ENSXMAG00000002401   Transcript: ENSXMAT00000002400
Sequence length 188
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556702.1:2666694:2669384:1 gene:ENSXMAG00000002401 transcript:ENSXMAT00000002400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKMLLYVNILILLVRDVALSSILTTPSRGCPTCTGKPVGLNVASLAPGEPCGVYTLNCAP
GLRCEPPQDEPRPLRALLEGRGVCSNVSSTTPTPQVYPAEPAPTEEPNEAPCRKLLMKVI
QGLDAHLFKSHHDIYIPNCDKSGFYKRKQCWSSLGKQRGKCWCVDENGLPVPPKTKQQGN
LHCTFNGD
Download sequence
Identical sequences M3ZJK3
ENSXMAP00000002395 ENSXMAP00000002395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]