SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003051 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003051
Domain Number 1 Region: 401-666
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-53
Family YWTD domain 0.00000214
Further Details:      
 
Domain Number 2 Region: 1021-1252
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-45
Family YWTD domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 716-970
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-42
Family YWTD domain 0.0000376
Further Details:      
 
Domain Number 4 Region: 315-393,667-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000761
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 5 Region: 62-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000982
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 6 Region: 20-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 7 Region: 106-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 192-229
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 9 Region: 144-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.0004
Further Details:      
 
Domain Number 10 Region: 975-1024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000579
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 235-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 276-310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000128
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 13 Region: 1284-1332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000023
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000003051
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00249
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003051   Gene: ENSXMAG00000003048   Transcript: ENSXMAT00000003056
Sequence length 1408
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557370.1:415:51715:-1 gene:ENSXMAG00000003048 transcript:ENSXMAT00000003056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASWKCDGDNDCLDGSDEESHSCYNHTCPDDQFKCNDNRCISKRWLCDGTNDCSNGEDEAN
TTCSARPCQSDQFACQNGRCIPRGWSCDRENDCGDMSDEISCTFPTCQPLTEFSCSNGRC
ISVKWHCDSDDDCGDGSDEVGCMQTCSNTQFQCTSGRCIPADWACDGDNDCGDFSDENTT
CRGGPALLPSVIECSGDEFHCVEDGTCIPERWRCDGDKDCEDGSDEKDCEGTKRMCDPKA
KFTCKDTGKCITKSWVCDGDIDCEDRSDEESCESSVCKPPKYPCANDSSVCLTPDKICNG
KVDCADRSDEGPICDMCLVARGGCSHQCTVAPGKGVVCSCPPGLHLDSSNKTCEAVDYCS
RHLKCSQVCEQYKTTVKCSCYSGWILDADGDSCHSIDPFEAFIIFSIRHEIRRIDLHKRD
YSLLVPGLRNTIALDFHFNRSLLYWTDVVEDKIYRGRLSETGGVAGIEVVVQHGLATPEG
LAVDWITGKLYWIDSNLDQIEVAKLNGEMRTTLIAGGMEHPRAIALDPGQGILFWTDWDA
TFPRIEAASMSGSGRHIVFKDMEIGAWPNGLTLDHLEKRIVWTDARSDAIFSALYDGTGV
IEILRGHEYLSHPFAVSLFGGNVYWTDWRTNTLARANKWTGQNVTVIQKTSAQPFDLQIF
HPSRQPQASNPCEENDGRGPCSHLCLINYNRSASCTCPHLMKLSANKQSCYALKRFLLYV
RRSEIRGVDIDNPYMNVMTALTVPDIDDVTVVDFDAQEERIYWADIKSQTIKRVFINGTQ
LETIISSDIANCRGLALDWLSKNLYWLSSENDESQINVARFDGSLKTSIIHGIDKPRCLV
VHPAKGKIYWTDGNTINMANMDGSNSKVLHQNQKDPVGLSIDFTANKLYWISSANGTINR
CNLDGGGLEVLETLKRVLAKGTALAVMGGKLWWADDESAQLGTVTKRDGRNFLILRNKTS
GVVHMKVYDREGHKGRNSCQVNNGGCSQLCFPTSENTRSCSCTVGYHLRSDRTSCEGVGS
FLLYSIHEGIRGIALDPNDNSEALMPITGTLFAVGVDFHAGNDTVYWTDMGLNRISRAKR
DQTWREDVITTGISRVEGIAVDWIAGNLYWTDHGFNLIEISRLNGAYRSVVISEGLDQPR
AIAVHPQKGYLFWSEWGQNPCIGRSRLDGSDQVTLVNSGIVWPNGISIDFEENTLYWCDA
RTDKIERINLETGESREIVMSAANVDLFSVAVFGPYIYWSDRAHSNGSIRRAFKTDASED
VTMKSGLGVNLKDVTVFNRDREKGTNPCARGNGGCQQLCFHLGSGRRTCSCAHGRLADDG
FACERYEGYLLFSERTILKSIHLSDENDLNSPVQPLENPAFFKNIVALAFDYNQSKSGTN
RIFFSDAHYGNIQIINDDWAGRYIIAES
Download sequence
Identical sequences M3ZLF9
ENSXMAP00000003051 ENSXMAP00000003051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]