SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003053 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003053
Domain Number 1 Region: 426-624
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-35
Family YWTD domain 0.0000283
Further Details:      
 
Domain Number 2 Region: 92-317
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-31
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 3 Region: 6-79,363-411
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000119
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003053   Gene: ENSXMAG00000003052   Transcript: ENSXMAT00000003058
Sequence length 627
Comment pep:novel scaffold:Xipmac4.4.2:JH557370.1:55291:91139:-1 gene:ENSXMAG00000003052 transcript:ENSXMAT00000003058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLSACHELRCRYGCVMTRNGTFCFCADGFEVGEDGTSCRDHDECAMYGACSQTCMNTYG
SYRCSCTEGYILQPDRISCRAKQDPGDSHPVLLIGSSNRIVITHLNGTGLQPLRSLSVNG
TLALDFQHTQERVCWALSTESSGQLRCAATRNLRGFTREQEIRTQRSIQHVEQMAIDWLT
GNFYFVEHASDKVFVCNRAGDTCVTILQLDLLNPKGIALDPLMGMLFITDYGNVAKLERC
NMDGSNRTRLVDYKMEQPTAVALDMIKKLVYWADAYLDYIDVVDYHGRNRHTIIHGIQVS
YVYALAVFEDYLYALHSAPLEESSSVELLQVNRFNITAESRTLASLGNSRALRVYHKLAQ
PKVRSHACEMDSYGKPGGCSQICLLSGSYKSRSCRCRIGYRLGFDGTSCKKPKNDFFLFY
GKGRPGVIRGLDMNIKSGDEHMVPIEDLVNPRAIDYHAEMGHIYFADTTSFLIGRQNIDG
SSRETILKDELDNVEGISVDWIGNNLYWTNDGYRKTISVARLERASQTRKTLLEGNMSHP
RAIVVDPLNSWMYWTDWEEDEVNDSIGRIEKAWMDGSNRRIFVTSNMLWPNGLTLDHSSS
TMYWCDAYYDHIEKIYLNGTGRMVCIY
Download sequence
Identical sequences M3ZLG1
ENSXMAP00000003053 ENSXMAP00000003053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]