SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003131 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003131
Domain Number 1 Region: 190-313
Classification Level Classification E-value
Superfamily EF-hand 7.06e-33
Family Osteonectin 0.013
Further Details:      
 
Domain Number 2 Region: 283-373
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.89e-22
Family Thyroglobulin type-1 domain 0.00092
Further Details:      
 
Domain Number 3 Region: 129-174
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000115
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003131   Gene: ENSXMAG00000003109   Transcript: ENSXMAT00000003136
Sequence length 419
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556725.1:1694318:1727051:1 gene:ENSXMAG00000003109 transcript:ENSXMAT00000003136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEMSDMVCLLAPLLMVAGSTLQADVKSVREAEKSGNFMEDEQWLSTISQYSRKIKHWNR
FRDDDYVRTWDENQGSNDNVDTTKDPCQKVKCSRHKVCIAQGYQRAVCVNRKKLEHRLKQ
PALRSPDGNCQPCPISSTGPVCGSDGHNYASKCKLEQQACLTGKALTLKCSGLCPCPTAA
PASREGKHESCTGQDLSDLGERLKDWFQLLQTNAKQNNNSKQGARSPAASTTSVLDRSLV
ASCKDSIGWMFSKLDTNNDLYLDQAELAAINLDKYEVCIRPYFNSCDSYRDGKVSTAEWC
LCFWREKPPCLAELERIQVQDGGKKKFGRFIPSCNEDGYYRKQQCDRGECWCVDQNGGEV
AGSRIRGKPDCDSEMTYSGDFGSAVGWEDEEEKEAEETAEEAEEEEGEVGEVDDGGYIW
Download sequence
Identical sequences M3ZLN9
ENSXMAP00000003131 ENSXMAP00000003131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]