SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003342 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXMAP00000003342
Domain Number - Region: 160-299,353-378
Classification Level Classification E-value
Superfamily YWTD domain 0.00194
Family YWTD domain 0.035
Further Details:      
 
Domain Number - Region: 23-94
Classification Level Classification E-value
Superfamily Tropomyosin 0.0222
Family Tropomyosin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003342   Gene: ENSXMAG00000003333   Transcript: ENSXMAT00000003347
Sequence length 389
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556773.1:100016:104624:1 gene:ENSXMAG00000003333 transcript:ENSXMAT00000003347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGFVLLLALVYSATAQHQALIDYLERRLLAIEDRISLWQEQTTRYASELRELKQQMVSQ
LESLDKEKETLRMTLDGVGTRVDRVERELDYLETQNGAQPCVDVDDKLIEQQVTLVKEKQ
KAKYFKLTDCSDMISSIKAMKILKRVGGPKGMWTKDAGGASGKVYIFNGTAEDTINEFST
VQDFTRSAGFSLSTDLKIPSSWKGTGHVVYNDHVYYVNQEEEIKVVKFDTKNKSITDSVV
FPVQDHVPVYGLNPETVMDLAVDEEGLWAIFATRQNERHISMAKMDSNSLDVEQMWDTNC
PRENAETAFIICGTLYVVYNTKQVGRSRVQCVFDVNDLVTNEEAPLVYFPKRYGFHASLK
YNPQEQLLYAWDDGYQILYKLSMKKKLEI
Download sequence
Identical sequences M3ZM99
ENSXMAP00000003342 ENSXMAP00000003342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]