SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003524 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003524
Domain Number 1 Region: 243-332
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 1.16e-16
Family PA3566-like 0.05
Further Details:      
 
Domain Number 2 Region: 24-140
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000144
Family Calmodulin-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003524   Gene: ENSXMAG00000003504   Transcript: ENSXMAT00000003529
Sequence length 346
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556677.1:2339735:2373055:-1 gene:ENSXMAG00000003504 transcript:ENSXMAT00000003529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCSEELQSVSEEPCTQLELKKGMSIFIDILRRADKNDDGKLSFDEFKSYFSDGVLTAEE
LKELFHTIDTHNTDNVDTDELCEYFSQHLGEYENVLAALEELNMSILKAMDKTKKDYQES
THLEQFVTRFLLKETTNQLHSLQSSLECAMETTAEQTRQEKQGPVKPEVLSIQLSGRRSN
RRLQRNNSLSPNNPLLSLVNSGAYDEDGQWTVQVNRLQKLIDRLEQKEIRMEPVEEEVLE
SKSHILIVQRQLSVLEEELEEFRLALRQYMDCACAQTGCLHIAVQRLANESRFILYEFWE
HNNVWKNHLQTNYSKTFQRGNVDFLETPESITTMLVPASWWVLNNN
Download sequence
Identical sequences M3ZMT1
ENSXMAP00000003524 ENSXMAP00000003524 XP_005797422.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]