SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003665 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003665
Domain Number 1 Region: 217-378
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.28e-45
Family Pentapeptide repeats 0.00019
Further Details:      
 
Domain Number 2 Region: 89-189
Classification Level Classification E-value
Superfamily POZ domain 1.02e-26
Family Tetramerization domain of potassium channels 0.0099
Further Details:      
 
Domain Number 3 Region: 2-76
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.000017
Family Doublecortin (DC) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003665   Gene: ENSXMAG00000003647   Transcript: ENSXMAT00000003670
Sequence length 389
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557059.1:159024:164014:1 gene:ENSXMAG00000003647 transcript:ENSXMAT00000003670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVTLFVNGTSKNGKVVAVYGTLSDLLSVASNKLGIKASCLYNGKGGLIDDIALIRDDD
VLYVSEGDPFIDPQSEVRVTSDQHGAHTDWLTLNIGGRLFTTTRSTLVSKEPESMLAHMF
REKDVWGNKQDKYGAYLIDRSPEYFEPILNYLRHGQLIVNEGINIRGVLEEARFFGIEQL
AEQLEVVIKNSQPPEDHSPISRKEFVRFLLATSTKSELRCQGLNFSGADLSRLDLRYINF
KMANLSRCNLTHANLCCSNLERADLSGANMDGANLQGVKMLCCNAEGASLKGCNFEDPSG
LKANLEGANLKGVDMEGSQMTGVNLRVATLKNAKLKNCNLRGATLAGTDLENCDLSGCDL
QEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences M3ZN72
XP_005811816.1.87360 ENSXMAP00000003665 ENSXMAP00000003665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]