SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003800 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003800
Domain Number 1 Region: 152-377,420-469
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.16e-48
Family Glycerol-3-phosphate transporter 0.036
Further Details:      
 
Domain Number 2 Region: 589-734
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.35e-18
Family Glycerol-3-phosphate transporter 0.047
Further Details:      
 
Domain Number 3 Region: 493-574
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000109
Family Pentapeptide repeats 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003800   Gene: ENSXMAG00000003782   Transcript: ENSXMAT00000003805
Sequence length 737
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556677.1:3515144:3537780:1 gene:ENSXMAG00000003782 transcript:ENSXMAT00000003805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGYQNRTAFIKGAKDIAKEVKRQASKKVGRSVDRMSDEYSKRSYSRFEEDDDDDYPMQ
GSQDGGYYRSDSQAANDDEGGHSDSTEGHDEDDEIYEGEYQGIPRADSGKGDLAGGPGSI
TAGAQQFKDVGASEAARRKDQEELAQQYETILQECGHGKFQWSLYFVLGLALMADGVEIF
VVGFVLPSAEKDMCLSEPSKSMLGLIVYFGMMVGAFLWGAMADRIGRRQSLIISLSINSI
FSFFSSFVQGYSTFLFCRLLSGVGIGGSIPIVFSYYSEFLSQEKRGEHLSWLCMFWMIGG
IYASAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVAAIAALNAMPESPRFYLEN
GKHDEGWMILKQVHDTNMRAKGHPERVFTVTTIKTVKQVDELVDIGTDTPVWQRYRLKIM
SLSQQIRNNILACFSPEYKRTTFMLMAVWFSMSFSYYGLTVWFPDMIKYIQKQEYESRTK
TFTKERVEHVTFNFTLENQVHRDGYYFNDKFLSLKMKSMVFEDSVFEECYFEDVTSTHTF
FRNCTFIASLFYNTDLFKYRLINSKLINSTFLHNKEGCMLDFSDDFNNAYMIYFVNFLGT
LAVLPGNIVSALLMDKIGRLRMLAGSSIISCVSCFFLMFGNSESGMIALLCLFGGISIAS
WNALDVITVELYPSDKRTTAFGFLNALCKLAAVLGISIFQSFVGITKAVPILFAGGALAA
GSFLATKLPETRGQVLQ
Download sequence
Identical sequences M3ZNK7
ENSXMAP00000003800 ENSXMAP00000003800 XP_005797454.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]