SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004091 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004091
Domain Number 1 Region: 33-353
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.39e-69
Family Rhodopsin-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004091   Gene: ENSXMAG00000004081   Transcript: ENSXMAT00000004096
Sequence length 384
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556770.1:705577:720339:1 gene:ENSXMAG00000004081 transcript:ENSXMAT00000004096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMDIFMNKGFGLTGNITQPTGGPEGNKGQGLNHSDPLDMFVGMELLQRFKPLFLPLYCL
VVVVAGVGNSFLLACILADKKLHNATNFFIGNLAAGDLLMCLSCVPLTVSYAFDSHGWAF
GQPLCHLVPLLQCATVFASVLSLTAIAVDRYIVVAHPVRKRISVWGCGAVTLGVWLLSLA
LAAPPSFYTRYLDLRPSGIDLVVCEEFWPDSGNLRLLYSCFILATSYMIPLLSVSISYCA
ITVSLKRYSVPGEASSSQQRWSQRRKKTFTLLVASVLAFALCWLPLQVLNLLLDLDPEFL
IIGKRYINVLQVCCHLVAMSSACYNPFIYASLHSKVRMHLKGYLCPCRSRRGEMVERAPS
RSGVFEASSVTAPVMQSHMIHPNI
Download sequence
Identical sequences M3ZPE8
XP_005804204.1.87360 ENSXMAP00000004091 ENSXMAP00000004091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]